Patents

Patents are legal documents drawn up by inventors and lawyers and granted by various patent offices around the world, to protect the inventors' intellectual property. The short description accompanying each patent in this Patents section is therefore taken from the legal document as is, with minor corrections for Greek symbols and obvious spelling errors. The patents included in this section may be for material products (defensins or defensin-like peptides or nucleic acid sequences, synthetic or natural) or for novel methods of detecting, quantitating, synthesizing, or delivering antimicrobial peptides/nucleic acid sequences in general. The curators' criterion for inclusion in this section is broader for novel methods than for material products, in the hope that these methods may in future be similarly applied to defensins.

Patents in which the defensins or defensin-like material products and methods as above are not novel, such as biomarker sets containing unmodified defensin or defensin-like peptides or oligonucleotides, are excluded from this section. The exception to such exclusions is where the patent provides other novel defensin-related material products or methods in addition to those non-novel of the biomarker set itself. This exclusion is because the reasonable presence of defensin or defensin-like sequences or indeed any other sequences in patented biomarker sets is necessarily attributed to some prior discovery of disease state correlation with such sequences. The curators have observed therefore that the novel discovery in biomarker-related patents is often the method of biomarker array analysis and validation as well as its resultant implications for diagnostics and prognostics. The expert evaluation of such biomarker analysis and validation is well outside the scope of the Defensins Knowledgebase. The reader is respectfully referred to a biomarker database specific to the disease to perform his own assessment of the validity of the biomarker.

Methods not pertaining to the antimicrobial activity of defensins, but where defensins or antimicrobial peptides or small cationic peptides or disulphide-bonded peptides or their respective nucleic acid sequences are suggested in some unambiguous detail to play a useful role in the method, with or without supporting experimental evidence, are included as well in this section. Patents in which natural defensins are up/downregulated in a clearly defined signal transduction pathway as a result of the unrelated patented novel compound or method are also included. And lastly, all patents showing experimental work done with defensins or antimicrobial peptides or small cationic peptides or disulphide-bonded peptides or their respective nucleic acid sequences, where such peptides or nucleic acid sequences are not the experimental controls, are included without exception.

The data in this section have been extracted from the academic version of SciFinder Scholar 2007 and from public Google search - a wide range of defensin-related patents are included.

Keywords:

Results 261 - 270 of 333

<< Previous | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | Next >>

Last updated: 20th February 2008

Patents
Patent No.: US 5997859
Method for treating a metastatic carcinoma using a conditionally lethal gene.
Applicant: Barber JR, Gruber HE, Jolly DJ (1999)
The present invention provides recombinant viral vectors carrying a vector construct which directs the expression of a gene product (e.g., HSVTK) that activates a compound with little or no cytotoxicity into a toxic product. Also provided are methods of destroying or inhibiting pathogenic agents in a warm blooded animal, comprising the step of administering to the animal a viral vector such as that described above, in order to inhibit or destroy the pathogenic agent.

Patent No.: US 5994306
Fine-tuned protegrins.
Applicant: Chang CC, Gu CL, Chen J, Steinberg DA, Lehrer RI, Harwig SSL (1999)
The invention is directed to antimicrobial peptides related to naturally-occurring protegrin peptides, and methods of using the peptides in a variety of contexts, including the treatment or prevention of infections.

Patent No.: US 5981469
78 residue polypeptide (NK-lysine) and its use.
Applicant: Andersson M, Boman HG, Jornvall H, Mutt V (1999)
A 78 residue polypeptide comprising the following amino acid sequence GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKK PQAICVDIKICKE [SEQ ID NO:1]: and functional derivatives and pharmaceutically acceptable salts thereof, said sequence comprising intra-linked half-cysteines; pharmaceutical composition containing such polypeptide as an active ingredient; a method for inhibiting microbial growth and cancer cell growth in animals including man; and nucleotide sequence corresponding to such polypeptide.

Patent No.: US 5972594
Method for screening for reproductive tract inflammation and preeclampsia using neutrophil defensins.
Applicant: Heine RP (1999)
A method and app. for screening for reproductive tract inflammation and preeclampsia which utilizes the increase in neutrophil defensins to indicate that a patient is at risk of having reproductive tract inflammation or preeclampsia. The app. consists either an ELISA based measurement of defensins levels or a dipstick test that can be administered by the provider or self-administered by the patient.

Patent No.: US 5972310
Aqueous foamable composition.
Applicant: Sachetto J-P (1999)
An aqueous foamable composition is provided having a delayed foaming action on expulsion from a pressurized container. The composition comprises a major amount of water, a water-immiscible liquified gas foaming agent, at least one foam-stabilizing and emulsifying surfactant, and a water-soluble polymer. The composition is particularly useful for rectal or vaginal administration of pharmaceuticals.

Patent No.: US 5969211
Pantropic retroviral vectors for gene transfer in mollusks.
Applicant: Burns JC, Chen TT (1999)
A method for introducing foreign nucleic acid sequences into marine mollusks. A pantropic retroviral vector containing a foreign gene sequence is introduced into fertilized mollusk embryos by electroporation. The gene sequence becomes integrated into the host DNA and encodes a functional protein product. This method has implications in the introduction of disease-resistance and growth-accelerating genes into mollusks.

Patent No.: US 5968904
Modified arginine containing lytic peptides and method of making the same by glyoxylation.
Applicant: Julian GR, Jaynes JM (1999)
A non-neurotoxin, arginine residue-containing non-naturally occurring lytic peptide comprising a sequence of amino acid residues in sufficient number and arrangement to confer lytic activity to the peptide, wherein the guanido groups of the arginine residues and the alpha-amino group of the N-terminal amino acid are sufficiently glyoxylated to impart enhanced tryptic, chymotryptic, and aminopeptidase digestion resistance to the peptide. The compositions of the invention are suitable for in vivo administration. A method of-making the same, to impart enhanced tryptic digestion resistance thereto, comprising glyoxylating the guanido groups of the arginine residues and the alpha-amino group of the N-terminal amino acid with glyoxa containing buffer for sufficient time and at sufficient conditions to glyoxylate the side chain and alpha-amino groups to sufficient extent to confer enhanced proteolytic digestion resistance to the peptide.

Patent No.: US 5965725
Polypeptides, and preparation and DNA encoding thereof.
Applicant: Iwanaga S, Kawabata S, Saito T (1999)
The present invention relates to polypeptide having a primary structure of amino acid sequence shown by Sequence List Sequence No. 1 and DNA encoding for the polypeptide. The polypeptide is obtainable by following steps (1)-(3): Step (1): extracting small granule fraction of homocytes of horseshoe crab with a buffer containing protein denaturing agent and chelating agent, Step (2): subjecting said extract to reverse phase high performance liquid chromatography, Step (3): eluting by concentration gradient elution with a hydrophobic organic solvent. Also, the polypeptide is produced by chemical synthesis. The polypeptide has similar chemical structure to defensin and is useful as gargles, disinfectants, antiseptics or antimicrobials.

Patent No.: US 5965519
Covalent polar lipid conjugates with biologically-active compounds for use in salves.
Applicant: Yatvin MB, Stowell MHB (1999)
This invention herein describes a method of facilitating the entry of drugs into cells and tissues at pharmokinetically useful levels and also a method of targeting drugs to specific organelles within the cell. This polar lipid/drug conjugate targeting invention embodies an advance over other drug targeting methods because through this method, intracellular drug concentrations may reach levels which are orders of magnitude higher than those achieved otherwise. Furthermore, it refines the drug delivery process by allowing therapeutic agents to be directed to certain intracellular structures. This technology is appropriate for use with antiproliferative, antibiotic, antimycotic, antiviral and antineoplastic drugs, in particular in combination with a multiplicity of other emollients and agents to make up topically-active substances such as salves, for rapid and efficient introduction of such agents through the epidermis for treatment of skin diseases and other disorders.

Patent No.: US 5962245
Methods for detecting the presence of advanced glycosylation endproducts.
Applicant: Li YM, Vlassara H, Cerami A (1999)
The present invention is directed to methods for detecting the presence of advanced glycosylation endproducts using the unexpected discovery that certain antibacterial proteins, in particular lysozyme and lactoferrin, bind to advanced glycosylation endproducts (AGEs) with high affinity, and that this binding activity is substantially noncompetitive with binding of bacterial carbohydrates to the antibacterial proteins. Accordingly, the invention relates to diagnostic methods for diseases and disorders associated with increased levels of AGEs, by using compositions having associated therewith a molecule having a hydrophilic loop domain, which domain is associated with AGE-binding activity, and compositions comprising such a domain. The invention further relates to compositions and devices for partitioning AGEs away from a sample.